SCF, Mouse (P.pastoris)

Name: SCF, Mouse (P.pastoris)
Brand: QuantiMol
SKU: QM-0200275-01
Price: 97.0 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0200275-01

£97.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SCF Protein, Mouse (P.pastoris) is the ligand for the receptor-type protein-tyrosine kinase KIT.It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis.
Molecular Formula
17311 (Gene_ID) P20826 (K26-A189) (Accession)
Smiles
MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Purity
96.7
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0200275-01	2 µgQM-0200275-01 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

10 µgQM-0200275-02	10 µgQM-0200275-02 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0200275-03	50 µgQM-0200275-03 £348.89/ea	£0.00	Quantity	£348.89/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SCF, Mouse (P.pastoris) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.