SCF, Rat (P.pastoris)

Name: SCF, Rat (P.pastoris)
Brand: QuantiMol
SKU: QM-0195231-01
Price: 147.63 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0195231-01

£147.63 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SCF Protein, Rat (P.pastoris) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.
Molecular Formula
60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)
Smiles
QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0195231-01	10 µgQM-0195231-01 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

50 µgQM-0195231-02	50 µgQM-0195231-02 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

100 µgQM-0195231-03	100 µgQM-0195231-03 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SCF, Rat (P.pastoris) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.