Skip to product information
1 of 1

SCN3B, Human (HEK293, His)

SCN3B, Human (HEK293, His)

Size

SKU:QM-0203479-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The SCN3B protein critically affects sodium channel dynamics, inducing unique sustained currents and slower inactivation rates compared to beta-1. Its interaction with NFASC is shown to guide sodium channels to the nodes of Ranvier during axonal development and retain them in mature myelinated axons. SCN3B Protein, Human (HEK293, His) is the recombinant human-derived SCN3B protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    55800 (Gene_ID) Q9NY72 (F23-E159) (Accession)

  • Smiles

    FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSE

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203479-01
5 µgQM-0203479-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0203479-02
10 µgQM-0203479-02
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0203479-03
50 µgQM-0203479-03
£284.50/ea
£0.00
£284.50/ea £0.00
100 µgQM-0203479-04
100 µgQM-0203479-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SCN3B, Human (HEK293, His)

SCN3B, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.