SCO1, Human (GST)

Name: SCO1, Human (GST)
Brand: QuantiMol
SKU: QM-0183831-01
Price: 205.52 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0183831-01

£205.52 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The SCO1 protein is a copper metal chaperone that contributes to the maturation of cytochrome c oxidase subunit II. SCO1 Protein, Human (GST) is the recombinant human-derived SCO1 protein, expressed by E. coli , with N-GST labeled tag.
Molecular Formula
6341 (Gene_ID) O75880 (G132-S301) (Accession)
Smiles
GKPLLGGPFSLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0183831-01	10 µgQM-0183831-01 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

50 µgQM-0183831-02	50 µgQM-0183831-02 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SCO1, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.