1 1

SCP2, Human (GST)

SCP2, Human (GST)

Size

QM-0118875

Price on request

Request quote or documents

View full details

Product Details

  • Description

    SCP2 Protein, Human (GST) is the recombinant human-derived SCP2 protein, expressed by E. coli, with N-GST tag.

  • Molecular Formula

    6342 (Gene_ID) P22307-2 (M1-L143) (Accession)

  • Smiles

    MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0118875
1 EachQM-0118875
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

SCP2, Human (GST)

SCP2, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.