Name: SDC4, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205614-01
Price: 67.44 GBP
Availability: InStock

Product Details

Description
SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
20971 (Gene_ID) O35988 (E24-V146) (Accession)
Smiles
ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEV
Purity
97.3
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205614-01	5 µgQM-0205614-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0205614-02	10 µgQM-0205614-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205614-03	50 µgQM-0205614-03 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

100 µgQM-0205614-04	100 µgQM-0205614-04 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

500 µgQM-0205614-05	500 µgQM-0205614-05 £1,212.76/ea	£0.00	Quantity	£1,212.76/ea	£0.00

1 mgQM-0205614-06	1 mgQM-0205614-06 £1,908.95/ea	£0.00	Quantity	£1,908.95/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SDC4, Mouse (HEK293, Fc)

SDC4, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.