SDC4, Mouse (HEK293, His)

Name: SDC4, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0193133-01
Price: 107.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0193133-01

£107.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
20971 (Gene_ID) O35988 (E24-E145) (Accession)
Smiles
ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTE
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0193133-01	10 µgQM-0193133-01 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0193133-02	50 µgQM-0193133-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SDC4, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.