Skip to product information
1 of 1

SECTM1, Human (HEK293, hFc)

SECTM1, Human (HEK293, hFc)

Size

SKU:QM-0202019-01

£109.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SECTM1 Protein potentially influences thymocyte signaling, indicating a role in thymic regulatory mechanisms. Its interaction with CD7 suggests involvement in cellular processes, potentially influencing thymocyte-associated signaling pathways. SECTM1's significance in thymocyte function and interaction with CD7 hints at a role in modulating immune responses and cellular communication within the thymic microenvironment. SECTM1 Protein, Human (HEK293, hFc) is the recombinant human-derived SECTM1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    6398 (Gene_ID) Q8WVN6 (Q29-G145) (Accession)

  • Smiles

    QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202019-01
5 µgQM-0202019-01
£109.38/ea
£0.00
£109.38/ea £0.00
10 µgQM-0202019-02
10 µgQM-0202019-02
£205.52/ea
£0.00
£205.52/ea £0.00
50 µgQM-0202019-03
50 µgQM-0202019-03
£481.32/ea
£0.00
£481.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SECTM1, Human (HEK293, hFc)

SECTM1, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.