SENP8, Human (His)
SENP8, Human (His)
SKU:QM-0092892
Request quote or documents

Product Details
-
Description
SENP8 protein, a pivotal protease in the NEDD8 pathway, plays a dual role in catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. SENP8's dual functionality underscores its crucial role in regulating NEDD8 modification, impacting various cellular pathways and functions. SENP8 Protein, Human (His) is the recombinant human-derived SENP8 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
123228 (Gene_ID) Q96LD8 (M1-K212) (Accession)
-
Smiles
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
SENP8, Human (His)
SENP8, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.