Skip to product information
1 of 1

SENP8, Human (His)

SENP8, Human (His)

Size

SKU:QM-0092892

Price on request
Quantity

Request quote or documents

View full details
  • Description

    SENP8 protein, a pivotal protease in the NEDD8 pathway, plays a dual role in catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. SENP8's dual functionality underscores its crucial role in regulating NEDD8 modification, impacting various cellular pathways and functions. SENP8 Protein, Human (His) is the recombinant human-derived SENP8 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    123228 (Gene_ID) Q96LD8 (M1-K212) (Accession)

  • Smiles

    MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0092892
1 EachQM-0092892
£0.00/ea
£0.00
£0.00/ea £0.00

SENP8, Human (His)

SENP8, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.