Serglycin/SRGN, Human (HEK293, His)

Name: Serglycin/SRGN, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0202788-01
Price: 67.44 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202788-01

£67.44 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Serglycin/SRGN Protein, Human (HEK293, His) is the recombinant human-derived Serglycin/SRGN, expressed by HEK293 , with C-10*His labeled tag.
Molecular Formula
5552 (Gene_ID) CAA34900.1/AAA60179.1 (Y28-L158) (Accession)
Smiles
YPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202788-01	5 µgQM-0202788-01 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

10 µgQM-0202788-02	10 µgQM-0202788-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0202788-03	50 µgQM-0202788-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0202788-04	100 µgQM-0202788-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Serglycin/SRGN, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.