Skip to product information
1 of 1

Serum amyloid A-3/Saa3, Mouse (P.pastoris, His)

Serum amyloid A-3/Saa3, Mouse (P.pastoris, His)

Size

SKU:QM-0203545-01

£145.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Serum amyloid A-3 protein/SAA3 is an important acute-phase reactant that plays a key role in responding to acute physiological challenges.As an important apolipoprotein in high-density lipoprotein (HDL) complexes, SAA3 contributes to the regulation of lipid metabolism, demonstrating its multifaceted role in maintaining homeostasis.Serum amyloid A-3 protein/SAA3 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Serum amyloid A-3 protein/SAA3 protein, expressed by P.pastoris , with N-6*His labeled tag.

  • Molecular Formula

    20210 (Gene_ID) P04918 (R20-Y122) (Accession)

  • Smiles

    RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203545-01
5 µgQM-0203545-01
£145.38/ea
£0.00
£145.38/ea £0.00
10 µgQM-0203545-02
10 µgQM-0203545-02
£271.13/ea
£0.00
£271.13/ea £0.00
50 µgQM-0203545-03
50 µgQM-0203545-03
£669.65/ea
£0.00
£669.65/ea £0.00
100 µgQM-0203545-04
100 µgQM-0203545-04
£1,046.30/ea
£0.00
£1,046.30/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Serum amyloid A-3/Saa3, Mouse (P.pastoris, His)

Serum amyloid A-3/Saa3, Mouse (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.