SH2D1A, Human (His)

Name: SH2D1A, Human (His)
Brand: QuantiMol
SKU: QM-0189781-01
Price: 141.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0189781-01

£141.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SH2D1A protein regulates receptors of the SLAM family (SLAMF1, CD244, LY9, CD84, SLAMF6, and SLAMF7) . SH2D1A Protein, Human (His) is the recombinant human-derived SH2D1A protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
4068 (Gene_ID) O60880 (M1-P128) (Accession)
Smiles
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Purity
95
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0189781-01	10 µgQM-0189781-01 £141.13/ea	£0.00	Quantity	£141.13/ea	£0.00

50 µgQM-0189781-02	50 µgQM-0189781-02 £330.15/ea	£0.00	Quantity	£330.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SH2D1A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.