Skip to product information
1 of 1

SHH, Human (C24II)

SHH, Human (C24II)

Size

SKU:QM-0205868-01

£75.72 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Sonic Hedgehog (SHH) Protein is a secretory glycoprotein of the Hedgehog family that can self-cleave to form N-SHH. SHH Protein activates Smo by binding to Frizzled and LRP6, inhibits GSK-3β to stabilize β-catenin, and activates FOXM1. SHH Protein also promotes NO release and shortens myocardial APD by phosphorylating eNOS through PI3K/Akt. SHH Protein can promote the maturation of sweat gland cells in three-dimensional culture and play a cardioprotective role in the pig ischemia-reperfusion model[1][2]. SHH Protein, Human (C24II) is a recombinant human SHH protein expressed in E. coli with C24II-mutation and tag-free.

  • Molecular Formula

    6469 (Gene_ID) Q15465 (G25-G197, C24II) (Accession)

  • Smiles

    IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205868-01
5 µgQM-0205868-01
£75.72/ea
£0.00
£75.72/ea £0.00
10 µgQM-0205868-02
10 µgQM-0205868-02
£119.50/ea
£0.00
£119.50/ea £0.00
50 µgQM-0205868-03
50 µgQM-0205868-03
£354.96/ea
£0.00
£354.96/ea £0.00
100 µgQM-0205868-04
100 µgQM-0205868-04
£570.02/ea
£0.00
£570.02/ea £0.00
500 µgQM-0205868-05
500 µgQM-0205868-05
£1,377.99/ea
£0.00
£1,377.99/ea £0.00
1 mgQM-0205868-06
1 mgQM-0205868-06
£1,932.04/ea
£0.00
£1,932.04/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SHH, Human (C24II)

SHH, Human (C24II) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.