SHH, Mouse (HEK293)

Name: SHH, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0194204-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0194204-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SHH Protein, Mouse (HEK293) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.
Molecular Formula
20423 (Gene_ID) Q62226 (C25-G198) (Accession)
Smiles
CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0194204-01	2 µgQM-0194204-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0194204-02	10 µgQM-0194204-02 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

50 µgQM-0194204-03	50 µgQM-0194204-03 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SHH, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.