Skip to product information
1 of 1

SIAE, Human (HEK293, His)

SIAE, Human (HEK293, His)

Size

SKU:QM-0176772-01

£241.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SIAE proteins play a key role in cellular processes by catalyzing the removal of the O-acetyl ester group specifically from the 9-position of the parent sialic acid N-acetylneuraminic acid. Through this enzymatic activity, SIAE helps regulate sialic acid modifications, affecting various biological functions associated with cell surface glycoconjugates. SIAE Protein, Human (HEK293, His) is the recombinant human-derived SIAE protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    54414 (Gene_ID) Q9HAT2-1 (I24-K523) (Accession)

  • Smiles

    IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAK

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0176772-01
10 µgQM-0176772-01
£241.46/ea
£0.00
£241.46/ea £0.00
50 µgQM-0176772-02
50 µgQM-0176772-02
£545.20/ea
£0.00
£545.20/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SIAE, Human (HEK293, His)

SIAE, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.