1 1

Siglec-15, Human (Biotinylated, HEK293, Fc-Avi)

Siglec-15, Human (Biotinylated, HEK293, Fc-Avi)

Size

QM-0177714-01

£365.90 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

  • Molecular Formula

    284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

  • Smiles

    FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
20 µgQM-0177714-01
20 µgQM-0177714-01
£365.90/ea		 £0.00
£365.90/ea £0.00
100 µgQM-0177714-02
100 µgQM-0177714-02
£935.74/ea		 £0.00
£935.74/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Siglec-15, Human (Biotinylated, HEK293, Fc-Avi)

Siglec-15, Human (Biotinylated, HEK293, Fc-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.