Siglec-15, Human (HEK293, His)

Name: Siglec-15, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0193902-01
Price: 122.88 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0193902-01

£122.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, His) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)
Smiles
FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0193902-01	10 µgQM-0193902-01 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0193902-02	50 µgQM-0193902-02 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0193902-03	100 µgQM-0193902-03 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Siglec-15, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.