1 1

Siglec-3/CD33, Cynomolgus/Rhesus Macaque (HEK293, His)

Siglec-3/CD33, Cynomolgus/Rhesus Macaque (HEK293, His)

Size

QM-0202944-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Siglec-3/CD33, a sialic-acid-binding lectin, crucially mediates cell-cell interactions and immune cell quiescence. Preferring sialic acid on specific mucins, it forms homodimers, interacting with PTPN6/SHP-1 and PTPN11/SHP-2 upon phosphorylation. CD33 also engages C1QA through its C-terminus, activating CD33 inhibitory motifs. Siglec-3/CD33 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    102117580 (Gene_ID) A0A2K5W2R5 (M16-G248) (Accession)

  • Smiles

    MDPRVRLEVQESVTVQEGLCVLVPCTFFHPVPYHTRNSPVHGYWFREGAIVSLDSPVATNKLDQEVREETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMEKGSTKYSYKSTQLSVHVTDLTHRPQILIPGALDPDHSKNLTCSVPWACEQGTPPIFSWMSAAPTSLGLRTTHSSVLIITPRPQDHGTNLTCQVKFPGAGVTTERTIQLNVSYASQNPRTDIFLGDGSG

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0202944-01
5 µgQM-0202944-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0202944-02
10 µgQM-0202944-02
£81.92/ea		 £0.00
£81.92/ea £0.00
50 µgQM-0202944-03
50 µgQM-0202944-03
£238.32/ea		 £0.00
£238.32/ea £0.00
100 µgQM-0202944-04
100 µgQM-0202944-04
£370.76/ea		 £0.00
£370.76/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Siglec-3/CD33, Cynomolgus/Rhesus Macaque (HEK293, His)

Siglec-3/CD33, Cynomolgus/Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.