Siglec-6, Human (HEK293, Fc)

Name: Siglec-6, Human (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0185929-01
Price: 76.75 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0185929-01

£76.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
946 (Gene_ID) O43699-3 (Q27-V331) (Accession)
Smiles
ERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0185929-01	10 µgQM-0185929-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

50 µgQM-0185929-02	50 µgQM-0185929-02 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Siglec-6, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.