Skip to product information
1 of 1

SIRT5, Human (Flag)

SIRT5, Human (Flag)

Size

SKU:QM-0205841-01

£74.68 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SIRT5 Proteins, belonging to the sirtuin family, possess a sirtuin core domain and share homology with yeast Sir2 protein. They are classified in class III of the sirtuin family and undergo alternative splicing, resulting in multiple transcript variants. Their ubiquitous expression in tissues like the heart, liver, and 25 others suggests their involvement in diverse cellular processes. SIRT5 Protein, Human (Flag) is the recombinant human-derived SIRT5 protein, expressed by E. coli , with N-Flag labeled tag.

  • Molecular Formula

    23408 (Gene_ID) Q9NXA8-1/NP_036373.1 (R2-S310) (Accession)

  • Smiles

    RPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205841-01
5 µgQM-0205841-01
£74.68/ea
£0.00
£74.68/ea £0.00
10 µgQM-0205841-02
10 µgQM-0205841-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0205841-03
50 µgQM-0205841-03
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0205841-04
100 µgQM-0205841-04
£520.20/ea
£0.00
£520.20/ea £0.00
500 µgQM-0205841-05
500 µgQM-0205841-05
£1,273.51/ea
£0.00
£1,273.51/ea £0.00
1 mgQM-0205841-06
1 mgQM-0205841-06
£1,997.64/ea
£0.00
£1,997.64/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SIRT5, Human (Flag)

SIRT5, Human (Flag) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.