SLAMF2/CD48, Human (HEK293, mFc)

Size 1 Each

SKU:QM-0126854

Price on request

Quote Datasheet SDS COA

Product Details

Description
SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, mFc) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-mFc labeled tag.
Molecular Formula
962 (Gene_ID) P09326 (Q27-S220) (Accession)
Smiles
QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
1 EachQM-0126854	1 EachQM-0126854 £0.00/ea	£0.00	Quantity	£0.00/ea	£0.00

SLAMF2/CD48, Human (HEK293, mFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.