SLAMF6, Mouse (HEK293, His)

Name: SLAMF6, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0202859-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202859-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SLAMF6 protein is a self-ligand receptor in the SLAM family, which complexly regulates the activation and differentiation of immune cells through homotypic or heterotypic interactions, affecting innate and adaptive immune responses. It relies on cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2 for activity control. SLAMF6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF6 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
30925 (Gene_ID) Q9ET39 (E31-N239) (Accession)
Smiles
EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202859-01	5 µgQM-0202859-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202859-02	10 µgQM-0202859-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0202859-03	50 µgQM-0202859-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0202859-04	100 µgQM-0202859-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SLAMF6, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.