SLC27A4/FATP4, Human (HEK293, His)
SLC27A4/FATP4, Human (HEK293, His)
SKU:QM-0169685-01
Couldn't load pickup availability
Request quote or documents

Product Details
-
Description
The SLC27A4/FATP4 protein centrally regulates cellular processes by regulating the levels of long-chain fatty acids (LCFA), which are critical for their transport across membranes. As the major LCFA transporter in small intestinal enterocytes, it plays a key role in early embryonic fat absorption. SLC27A4/FATP4 Protein, Human (HEK293, His) is the recombinant human-derived SLC27A4/FATP4 protein, expressed by HEK293 , with N-His labeled tag.
-
Molecular Formula
10999 (Gene_ID) Q6P1M0-1 (Q483-L643) (Accession)
-
Smiles
QAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
-
Purity
96
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0055073-01 (10Z,13Z) -Nonadeca-10,13-dienoic acid [CAS 29204-20-4]
- QM-0055025-01 20-O-Acetylcamptothecin [CAS 7688-64-4]
- QM-0055022 3'-Azidomethyi-dGTP [CAS 1048022-06-5]
- QM-0054666 DGTPαS [CAS 82337-56-2]
- QM-0054664 DATPαS [CAS 64145-28-4]
- QM-0054663 3’-O-Acetyl-dATP (sodium)
- QM-0054662 3'-O-Acetyl-dATP [CAS 28120-63-0]
- QM-0054521-01 Methoxycarbonyl Cefadroxil-d6 [CAS 1246819-89-5]
Other industry favorites
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0053863 L- (+) -Ampicillin-d5
- QM-0053811 L-Glutathione reduced-d5 (ammonium)
- QM-0053172 Methacryloyl-CoA [CAS 6008-91-9]
- QM-0053171 3-Hydroxy-2-methylbutyryl-CoA [CAS 6701-38-8]
- QM-0054252 Acetyl-L-carnitine (hydrochloride) -13C3
- QM-0054203-01 MDMB-FUBINACA metabolite M1 [CAS 2693397-47-4]
- QM-0053343-01 2-Bromoamphetamine (hydrochloride) [CAS 861006-36-2]
- QM-0053309-01 3-Oxohexadecanoyl-CoA [CAS 34619-89-1]
SLC27A4/FATP4, Human (HEK293, His)
SLC27A4/FATP4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.