1 1

SLC27A4/FATP4, Human (HEK293, His)

SLC27A4/FATP4, Human (HEK293, His)

Size

QM-0169685-01

£76.75 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The SLC27A4/FATP4 protein centrally regulates cellular processes by regulating the levels of long-chain fatty acids (LCFA), which are critical for their transport across membranes. As the major LCFA transporter in small intestinal enterocytes, it plays a key role in early embryonic fat absorption. SLC27A4/FATP4 Protein, Human (HEK293, His) is the recombinant human-derived SLC27A4/FATP4 protein, expressed by HEK293 , with N-His labeled tag.

  • Molecular Formula

    10999 (Gene_ID) Q6P1M0-1 (Q483-L643) (Accession)

  • Smiles

    QAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0169685-01
5 µgQM-0169685-01
£76.75/ea		 £0.00
£76.75/ea £0.00
10 µgQM-0169685-02
10 µgQM-0169685-02
£111.63/ea		 £0.00
£111.63/ea £0.00
50 µgQM-0169685-03
50 µgQM-0169685-03
£293.00/ea		 £0.00
£293.00/ea £0.00
100 µgQM-0169685-04
100 µgQM-0169685-04
£437.58/ea		 £0.00
£437.58/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

SLC27A4/FATP4, Human (HEK293, His)

SLC27A4/FATP4, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.