1 1

SLC34A2, Human (HEK293, His, mFc)

SLC34A2, Human (HEK293, His, mFc)

Size

QM-0026179

Price on request

Request quote or documents

View full details

Product Details

  • Description

    SLC34A2 Protein, Human (HEK293, His, mFc) is the recombinant human-derived SLC34A2 protein, expressed by HEK293, with N-10*His & C-mFc tag.

  • Molecular Formula

    10568 (Gene_ID) O95436-1 (V234-L362) (Accession)

  • Smiles

    VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0026179
1 EachQM-0026179
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

SLC34A2, Human (HEK293, His, mFc)

SLC34A2, Human (HEK293, His, mFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.