SMAD3, Human/Mouse/Rat (Flag-His)

Name: SMAD3, Human/Mouse/Rat (Flag-His)
Brand: QuantiMol
SKU: QM-0173014-01
Price: 152.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0173014-01

£152.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The SMAD3 protein acts as a receptor-regulated SMAD (R-SMAD), transducing signals from TGF-β and activin type 1 receptor kinase. After being activated by antigen-presenting cells, SMAD3 binds to the TRE element in the gene promoter and forms a complex with SMAD4 to activate transcription. SMAD3 Protein, Human/Mouse/Rat (Flag-His) is the recombinant human-derived SMAD3 protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.
Molecular Formula
4088/17127/25631 (Gene_ID) P84022-1/Q8BUN5/P84025 (S2-S425) (Accession)
Smiles
SSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Purity
93.92
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0173014-01	10 µgQM-0173014-01 £152.38/ea	£0.00	Quantity	£152.38/ea	£0.00

50 µgQM-0173014-02	50 µgQM-0173014-02 £406.69/ea	£0.00	Quantity	£406.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SMAD3, Human/Mouse/Rat (Flag-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.