SMNDC1/SPF30, Human (His)

Name: SMNDC1/SPF30, Human (His)
Brand: QuantiMol
SKU: QM-0204035-01
Price: 79.85 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204035-01

£79.85 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SMNDC1/SPF30 Protein is pivotal in spliceosome assembly, forming associations with spliceosomes, U4/U5/U6 tri-snRNP, and U2 snRNP. Its Tudor domain directly interacts with SNRPD3, emphasizing its crucial role in essential interactions within the splicing machinery and contributing to the intricate process of pre-mRNA splicing. SMNDC1/SPF30 Protein, Human (His) is the recombinant human-derived SMNDC1/SPF30 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
10285 (Gene_ID) O75940 (M1-Q238) (Accession)
Smiles
MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Purity
85.2
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204035-01	5 µgQM-0204035-01 £79.85/ea	£0.00	Quantity	£79.85/ea	£0.00

10 µgQM-0204035-02	10 µgQM-0204035-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0204035-03	50 µgQM-0204035-03 £342.81/ea	£0.00	Quantity	£342.81/ea	£0.00

100 µgQM-0204035-04	100 µgQM-0204035-04 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SMNDC1/SPF30, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.