Name: SMPDL3A, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0205471-01
Price: 62.26 GBP
Availability: InStock

Product Details

Description
SMPDL3A protein hydrolyzes nucleotide triphosphates, particularly ATP, and p-nitrophenyl-TMP. It has limited activity with nucleoside diphosphates and none with nucleoside monophosphates. SMPDL3A also catalyzes the conversion of CDP-choline to CMP and phosphocholine, and CDP-ethanolamine. However, it lacks sphingomyelin phosphodiesterase activity. SMPDL3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SMPDL3A protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
57319 (Gene_ID) P70158/NP_065586.3 (V23-L445) (Accession)
Smiles
VPLAPADRAPAVGQFWHVTDLHLDPTYHITDDRTKVCASSKGANASNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPALGNHDYWPQDQLPIVTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNPGLRIISLNTNLYYGPNIMTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNGNPLNSVFVAPAVTPVKGVLQKETNNPGVRLFQYKPGDYTLLDMVQYYLNLTEANLKGESNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQHCKTLQVCAIMNLDSMSYDDCLKQHL
Purity
98.6
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0205471-01	5 µgQM-0205471-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0205471-02	10 µgQM-0205471-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0205471-03	50 µgQM-0205471-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0205471-04	100 µgQM-0205471-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

500 µgQM-0205471-05	500 µgQM-0205471-05 £1,100.97/ea	£0.00	Quantity	£1,100.97/ea	£0.00

1 mgQM-0205471-06	1 mgQM-0205471-06 £1,837.27/ea	£0.00	Quantity	£1,837.27/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SMPDL3A, Mouse (HEK293, His)

SMPDL3A, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.