Skip to product information
1 of 1

SMYD2, Human (sf9, His)

SMYD2, Human (sf9, His)

Size

SKU:QM-0202968-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The SMYD2 protein is a multifunctional methyltransferase that can modify histones and non-histone proteins, including p53/TP53 and RB1. Notably, it trimethylates H3 at "Lys-4" (H3K4me3), which is critical for gene activation. SMYD2 Protein, Human (sf9, His) is the recombinant human-derived SMYD2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

  • Molecular Formula

    56950 (Gene_ID) Q9NRG4-1 (M1-H433) (Accession)

  • Smiles

    MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202968-01
5 µgQM-0202968-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0202968-02
10 µgQM-0202968-02
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0202968-03
50 µgQM-0202968-03
£249.26/ea
£0.00
£249.26/ea £0.00
100 µgQM-0202968-04
100 µgQM-0202968-04
£370.76/ea
£0.00
£370.76/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SMYD2, Human (sf9, His)

SMYD2, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.