Skip to product information
1 of 1

SNCA, Human (His)

SNCA, Human (His)

Size

SKU:QM-0205444-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Alpha-synuclein (SNCA) is a key neuronal protein that regulates synaptic activity, including vesicle transport and neurotransmitter release. As a monomer, it enhances vesicle exocytosis, promotes fusion and fusion pore expansion, and increases local Ca (2+) release. SNCA Protein, Human (His) is the recombinant human-derived SNCA protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    6622 (Gene_ID) P37840-1 (M1-A140) (Accession)

  • Smiles

    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205444-01
2 µgQM-0205444-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0205444-02
10 µgQM-0205444-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0205444-03
50 µgQM-0205444-03
£147.63/ea
£0.00
£147.63/ea £0.00
100 µgQM-0205444-04
100 µgQM-0205444-04
£249.26/ea
£0.00
£249.26/ea £0.00
500 µgQM-0205444-05
500 µgQM-0205444-05
£470.39/ea
£0.00
£470.39/ea £0.00
1 mgQM-0205444-06
1 mgQM-0205444-06
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SNCA, Human (His)

SNCA, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.