Skip to product information
1 of 1

SP-D, Human (HEK293)

SP-D, Human (HEK293)

Size

SKU:QM-0169625-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Surfactant protein-D Protein, Human (HEK293) produced in HEK293 cells is a multimeric collectin that is involved in innate immune defense and expressed in pulmonary, as well as non-pulmonary, epithelia. Surfactant protein-D Protein exerts antimicrobial effects and dampens inflammation through direct microbial interactions and modulation of host cell responses via a series of cellular receptors.

  • Molecular Formula

    6441 (Gene_ID) P35247 (A21-F375) (Accession)

  • Smiles

    AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0169625-01
10 µgQM-0169625-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0169625-02
50 µgQM-0169625-02
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SP-D, Human (HEK293)

SP-D, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.