Skip to product information
1 of 1

SP-D, Rhesus Macaque (HEK293, His)

SP-D, Rhesus Macaque (HEK293, His)

Size

SKU:QM-0076324-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived SP-D protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    678657 (Gene_ID) Q1PBC5/NP_001035283.1 (D22-F375) (Accession)

  • Smiles

    DMKTYSQRTAPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGKAGMPGEAGPVGPKGDNGSIGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGPAGPKGDRGVPGERGAPGNAGAAGSAGVMGPQGSPGARGPPGLKGDKGVPGDKGAKGESGLPDVASLRQQVEALQKQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLVCTQAGGQLASPRSAAENAALQQLVIAQNEAAFLSMTDSKMEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

  • Purity

    95.5

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0076324-01
5 µgQM-0076324-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0076324-02
10 µgQM-0076324-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0076324-03
50 µgQM-0076324-03
£238.32/ea
£0.00
£238.32/ea £0.00
100 µgQM-0076324-04
100 µgQM-0076324-04
£370.76/ea
£0.00
£370.76/ea £0.00
500 µgQM-0076324-05
500 µgQM-0076324-05
£1,079.11/ea
£0.00
£1,079.11/ea £0.00
1 mgQM-0076324-06
1 mgQM-0076324-06
£1,798.38/ea
£0.00
£1,798.38/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SP-D, Rhesus Macaque (HEK293, His)

SP-D, Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.