SPARC, Human

Name: SPARC, Human
Brand: QuantiMol
SKU: QM-0201235-01
Price: 117.25 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0201235-01

£117.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SPARC Protein, Human is a Ca2+-binding glycoprotein that is differentially associated with morphogenesis, remodeling, cellular migration, and proliferation.
Molecular Formula
6678 (Gene_ID) P09486 (A18-I303) (Accession)
Smiles
APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0201235-01	10 µgQM-0201235-01 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0201235-02	50 µgQM-0201235-02 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

100 µgQM-0201235-03	100 µgQM-0201235-03 £409.64/ea	£0.00	Quantity	£409.64/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SPARC, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.