SPARC, Human (HEK293, His)

Name: SPARC, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0204457-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0204457-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
SPARC proteins are essential for lipid transport and are involved in the production, transformation, and clearance of plasma lipoproteins. It interacts with different particles, shows a preference for HDL, and binds to cellular receptors such as LDLR and VLDLR to promote the uptake of APOE-containing lipoproteins. SPARC Protein, Human (HEK293, His) is the recombinant human-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
6678 (Gene_ID) P09486 (A18-I303) (Accession)
Smiles
APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204457-01	5 µgQM-0204457-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204457-02	10 µgQM-0204457-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0204457-03	50 µgQM-0204457-03 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

100 µgQM-0204457-04	100 µgQM-0204457-04 £243.19/ea	£0.00	Quantity	£243.19/ea	£0.00

500 µgQM-0204457-05	500 µgQM-0204457-05 £658.72/ea	£0.00	Quantity	£658.72/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SPARC, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.