SPG21, Human (sf9, His)

Name: SPG21, Human (sf9, His)
Brand: QuantiMol
SKU: QM-0203461-01
Price: 98.65 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203461-01

£98.65 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The SPG21 protein may act as a negative regulator in CD4-dependent T cell activation, suggesting its role in regulating immune responses. Its interaction with CD4 suggests a molecular link affecting CD4-mediated T cell activation pathways. SPG21 Protein, Human (sf9, His) is the recombinant human-derived SPG21 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Molecular Formula
51324 (Gene_ID) Q9NZD8-1 (M1-Q308) (Accession)
Smiles
MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Purity
96
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203461-01	5 µgQM-0203461-01 £98.65/ea	£0.00	Quantity	£98.65/ea	£0.00

10 µgQM-0203461-02	10 µgQM-0203461-02 £136.63/ea	£0.00	Quantity	£136.63/ea	£0.00

50 µgQM-0203461-03	50 µgQM-0203461-03 £318.00/ea	£0.00	Quantity	£318.00/ea	£0.00

100 µgQM-0203461-04	100 µgQM-0203461-04 £462.58/ea	£0.00	Quantity	£462.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

SPG21, Human (sf9, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.