Skip to product information
1 of 1

SREC-I/SCARF1, Human (HEK293, His)

SREC-I/SCARF1, Human (HEK293, His)

Size

SKU:QM-0205505-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SREC-I/SCARF1 Protein acts as a multifunctional mediator, facilitating Ac-LDL binding and degradation, suggesting a role in lipid metabolism and adhesion. Involved in neurite-like outgrowth, it interacts with SREC2 and AVIL, forming a complex molecular network. The protein's diverse roles underscore its significance in various cellular processes beyond lipid metabolism. SREC-I/SCARF1 Protein, Human (HEK293, His) is the recombinant human-derived SREC-I/SCARF1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    8578 (Gene_ID) Q14162 (S20-T421) (Accession)

  • Smiles

    SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205505-01
2 µgQM-0205505-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0205505-02
10 µgQM-0205505-02
£221.31/ea
£0.00
£221.31/ea £0.00
50 µgQM-0205505-03
50 µgQM-0205505-03
£492.26/ea
£0.00
£492.26/ea £0.00
100 µgQM-0205505-04
100 µgQM-0205505-04
£758.35/ea
£0.00
£758.35/ea £0.00
250 µgQM-0205505-05
250 µgQM-0205505-05
£1,377.99/ea
£0.00
£1,377.99/ea £0.00
500 µgQM-0205505-06
500 µgQM-0205505-06
£2,097.28/ea
£0.00
£2,097.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SREC-I/SCARF1, Human (HEK293, His)

SREC-I/SCARF1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.