Skip to product information
1 of 1

SsPA, E. coli (His)

SsPA, E. coli (His)

Size

SKU:QM-0200307-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The ssPA protein specifically forms an equimolar complex with RNA polymerase holoenzyme (RNAP), thereby distinguishing its interaction preference from the core enzyme. ssPA is primarily synthesized during amino acid starvation and accounts for more than 50% of the total protein produced under these conditions. ssPA Protein, E. coli (His) is the recombinant E. coli-derived ssPA protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    61751941 (Gene_ID) P0ACA3 (M1-S212) (Accession)

  • Smiles

    MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLMNTIINGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDCYLAPLLWRLPQLGIEFSGPGAKELKGYMTRVFERDSFLASLTEAEREMRLGRS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0200307-01
5 µgQM-0200307-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0200307-02
10 µgQM-0200307-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0200307-03
50 µgQM-0200307-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SsPA, E. coli (His)

SsPA, E. coli (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.