Skip to product information
1 of 1

Staphopain B, S. aureus (GST)

Staphopain B, S. aureus (GST)

Size

SKU:QM-0202972-01

£216.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Staphopain B is a cysteine protease that severely disrupts host immunity by degrading elastin, fibrin, fibronectin, and kininogen. It blocks phagocytosis of opsonized Staphylococcus aureus and induces neutrophil and monocyte death through proteolytic activity. Staphopain B Protein, S. aureus (GST) is the recombinant Staphylococcus aureus-derived Staphopain B protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    / (Gene_ID) Q99V46 (D220-Y393) (Accession)

  • Smiles

    DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202972-01
5 µgQM-0202972-01
£216.46/ea
£0.00
£216.46/ea £0.00
10 µgQM-0202972-02
10 µgQM-0202972-02
£337.95/ea
£0.00
£337.95/ea £0.00
20 µgQM-0202972-03
20 µgQM-0202972-03
£504.41/ea
£0.00
£504.41/ea £0.00
50 µgQM-0202972-04
50 µgQM-0202972-04
£913.87/ea
£0.00
£913.87/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Staphopain B, S. aureus (GST)

Staphopain B, S. aureus (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.