Skip to product information
1 of 1

Staphylokinase, S. aureus

Staphylokinase, S. aureus

Size

SKU:QM-0171557-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Staphylokinase Protein efficiently converts plasminogen into active plasmin, a key enzyme in fibrinolysis. It forms a 1:1 complex with plasmin, activating additional plasminogen molecules and amplifying the fibrinolytic cascade. Staphylokinase Protein, S. aureus is the recombinant Staphylococcus aureus-derived Staphylokinase protein, expressed by E. coli , with tag free.

  • Molecular Formula

    58067813 (Gene_ID) P68802 (S28-K163) (Accession)

  • Smiles

    SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0171557-01
10 µgQM-0171557-01
£62.26/ea
£0.00
£62.26/ea £0.00
50 µgQM-0171557-02
50 µgQM-0171557-02
£147.63/ea
£0.00
£147.63/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Staphylokinase, S. aureus

Staphylokinase, S. aureus is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.