STC2/Stanniocalcin-2, Mouse

Name: STC2/Stanniocalcin-2, Mouse
Brand: QuantiMol
SKU: QM-0175448-01
Price: 227.39 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0175448-01

£227.39 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The STC2/Stanniocalcin-2 protein exerts anti-hypocalcemia effects and is actively involved in the regulation of calcium and phosphate homeostasis.Its role in maintaining the balance of these essential minerals emphasizes its importance in physiological processes related to mineral metabolism.STC2/Stanniocalcin-2 Protein, Mouse is the recombinant mouse-derived STC2/Stanniocalcin-2 protein, expressed by E.coli , with tag free.
Molecular Formula
20856 (Gene_ID) O88452 (T25-R296) (Accession)
Smiles
TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0175448-01	20 µgQM-0175448-01 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0175448-02	50 µgQM-0175448-02 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0175448-03	100 µgQM-0175448-03 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

STC2/Stanniocalcin-2, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.