Skip to product information
1 of 1

Stratifin, Human (N-His, C-Myc)

Stratifin, Human (N-His, C-Myc)

Size

SKU:QM-0206009-01

£69.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

  • Molecular Formula

    2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

  • Smiles

    MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0206009-01
5 µgQM-0206009-01
£69.50/ea
£0.00
£69.50/ea £0.00
10 µgQM-0206009-02
10 µgQM-0206009-02
£101.50/ea
£0.00
£101.50/ea £0.00
20 µgQM-0206009-03
20 µgQM-0206009-03
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0206009-04
50 µgQM-0206009-04
£337.95/ea
£0.00
£337.95/ea £0.00
100 µgQM-0206009-05
100 µgQM-0206009-05
£537.21/ea
£0.00
£537.21/ea £0.00
500 µgQM-0206009-06
500 µgQM-0206009-06
£1,323.32/ea
£0.00
£1,323.32/ea £0.00
1 mgQM-0206009-07
1 mgQM-0206009-07
£2,097.28/ea
£0.00
£2,097.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Stratifin, Human (N-His, C-Myc)

Stratifin, Human (N-His, C-Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.