Skip to product information
1 of 1

STUB1, Human

STUB1, Human

Size

SKU:QM-0192542-01

£160.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90) . STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    10273 (Gene_ID) Q9UNE7 (M1-Y303) (Accession)

  • Smiles

    MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0192542-01
10 µgQM-0192542-01
£160.25/ea
£0.00
£160.25/ea £0.00
50 µgQM-0192542-02
50 µgQM-0192542-02
£406.69/ea
£0.00
£406.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

STUB1, Human

STUB1, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.