SULT1A2, Human (His)
SULT1A2, Human (His)
SKU:QM-0135210
Request quote or documents

Product Details
-
Description
Sulfotransferase 1A2 (SULT1A2) is a phenol sulfotransferase with thermostable enzyme activity. SULT1A2 utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A2 is also responsible for the sulfonation and activation of minoxidil. SULT1A2 induces the mutagenicity and carcinogenicity of certain substrates by influencing DNA adduct formation. SULT1A2 Protein, Human (His) is the recombinant human-derived SULT1A2 protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
6799 (Gene_ID) AAI13728.1 (M1-L295) (Accession)
-
Smiles
MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
SULT1A2, Human (His)
SULT1A2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.