Skip to product information
1 of 1

SULT1A3, Human (His, solution)

SULT1A3, Human (His, solution)

Size

SKU:QM-0191142-01

£263.32 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (His, solution) is the recombinant human-derived SULT1A3 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    445329 (Gene_ID) P0DMM9-1 (M1-L295) (Accession)

  • Smiles

    MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0191142-01
10 µgQM-0191142-01
£263.32/ea
£0.00
£263.32/ea £0.00
50 µgQM-0191142-02
50 µgQM-0191142-02
£639.98/ea
£0.00
£639.98/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SULT1A3, Human (His, solution)

SULT1A3, Human (His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.