Skip to product information
1 of 1

SULT2A1, Human (His)

SULT2A1, Human (His)

Size

SKU:QM-0182731-01

£152.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    6822 (Gene_ID) Q06520 (S2-E285) (Accession)

  • Smiles

    SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0182731-01
10 µgQM-0182731-01
£152.38/ea
£0.00
£152.38/ea £0.00
50 µgQM-0182731-02
50 µgQM-0182731-02
£390.90/ea
£0.00
£390.90/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SULT2A1, Human (His)

SULT2A1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.