Skip to product information
1 of 1

SUMO3, Human (HEK293, His)

SUMO3, Human (HEK293, His)

Size

SKU:QM-0190177-01

£88.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SUMO3 is a multifunctional ubiquitin-like protein that can attach to target lysines, acting as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 is not involved in protein degradation; instead, it may counteract ubiquitin degradation. SUMO3 Protein, Human (HEK293, His) is the recombinant human-derived SUMO3 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    6612 (Gene_ID) P55854 (S2-G92) (Accession)

  • Smiles

    SEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0190177-01
10 µgQM-0190177-01
£88.00/ea
£0.00
£88.00/ea £0.00
50 µgQM-0190177-02
50 µgQM-0190177-02
£227.39/ea
£0.00
£227.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SUMO3, Human (HEK293, His)

SUMO3, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.