Skip to product information
1 of 1

SWSAP1, Human (His)

SWSAP1, Human (His)

Size

SKU:QM-0082135-01

£241.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    SWSAP1, an ATPase selectively activated by single-stranded DNA, is vital for homologous recombination repair (HRR) . In addition to ATPase activity, SWSAP1 independently binds DNA. Teaming up with ZSWIM7, it forms a complex crucial for HRR, with mutual stabilization. SWSAP1 interacts with key HRR proteins—RAD51, RAD51B, RAD51C, RAD51D, and XRCC3—underscoring its role in facilitating homologous recombination repair processes. SWSAP1 Protein, Human (His) is the recombinant human-derived SWSAP1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    126074 (Gene_ID) Q6NVH7 (M1-P229) (Accession)

  • Smiles

    MPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMVALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGLGPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0082135-01
10 µgQM-0082135-01
£241.46/ea
£0.00
£241.46/ea £0.00
50 µgQM-0082135-02
50 µgQM-0082135-02
£540.35/ea
£0.00
£540.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

SWSAP1, Human (His)

SWSAP1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.