Skip to product information
1 of 1

Syndecan-2, Human (HEK293, His)

Syndecan-2, Human (HEK293, His)

Size

SKU:QM-0172034-01

£107.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Syndecan-2 Protein is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    6383 (Gene_ID) AAH49836.1 (E19-E144) (Accession)

  • Smiles

    ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0172034-01
10 µgQM-0172034-01
£107.13/ea
£0.00
£107.13/ea £0.00
50 µgQM-0172034-02
50 µgQM-0172034-02
£316.08/ea
£0.00
£316.08/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Syndecan-2, Human (HEK293, His)

Syndecan-2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.