Name: Syndecan-4, Human
Brand: QuantiMol
SKU: QM-0027571-01
Price: 76.75 GBP
Availability: InStock

Product Details

Description
Studies have proven that Syndecan-4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to play a key role in regulating exosome biogenesis. Syndecan-4 functions as a homodimer and interacts with various intracellular partners through its cytoplasmic domain. Syndecan-4 Protein, Human is the recombinant human-derived Syndecan-4 protein, expressed by E. coli , with tag free.
Molecular Formula
6385 (Gene_ID) P31431-1 (E19-E145) (Accession)
Smiles
ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0027571-01	5 µgQM-0027571-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0027571-02	10 µgQM-0027571-02 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0027571-03	50 µgQM-0027571-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0027571-04	100 µgQM-0027571-04 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

500 µgQM-0027571-05	500 µgQM-0027571-05 £1,599.13/ea	£0.00	Quantity	£1,599.13/ea	£0.00

1 mgQM-0027571-06	1 mgQM-0027571-06 £2,705.99/ea	£0.00	Quantity	£2,705.99/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Syndecan-4, Human

Syndecan-4, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.