Syntenin-1, Human (N-His)

Name: Syntenin-1, Human (N-His)
Brand: QuantiMol
SKU: QM-0202804-01
Price: 73.65 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202804-01

£73.65 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Syntenin-1 protein is known to mediate Syndecan signaling and has a PDZ domain that binds transmembrane proteins. It affects cytoskeletal membrane organization, cell adhesion, protein trafficking, and transcription factor activation. Syntenin-1 Protein, Human (N-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
6386 (Gene_ID) NP_001007068.1 (M1-V298) (Accession)
Smiles
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Purity
96.4
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202804-01	5 µgQM-0202804-01 £73.65/ea	£0.00	Quantity	£73.65/ea	£0.00

10 µgQM-0202804-02	10 µgQM-0202804-02 £115.00/ea	£0.00	Quantity	£115.00/ea	£0.00

50 µgQM-0202804-03	50 µgQM-0202804-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0202804-04	100 µgQM-0202804-04 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Syntenin-1, Human (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.