Skip to product information
1 of 1

TAFA4, Human (His)

TAFA4, Human (His)

Size

SKU:QM-0183727-01

£137.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    TAFA4 protein, a modulator of injury-induced and chemical pain hypersensitivity, influences pain responses. It serves as a ligand for FPR1, chemoattracting macrophages, enhancing phagocytosis, and elevating reactive oxygen species (ROS) release. TAFA4's multifaceted role indicates involvement in immune responses and cellular processes related to inflammation and injury. TAFA4 Protein, Human (His) is the recombinant human-derived TAFA4 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    151647 (Gene_ID) Q96LR4 (S35-R140) (Accession)

  • Smiles

    SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0183727-01
10 µgQM-0183727-01
£137.50/ea
£0.00
£137.50/ea £0.00
50 µgQM-0183727-02
50 µgQM-0183727-02
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

TAFA4, Human (His)

TAFA4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.